PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj1g3v2140900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family SRS
Protein Properties Length: 270aa    MW: 29397.8 Da    PI: 8.2944
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj1g3v2140900.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702174.74.5e-54782073154
           DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaes 96 
                       g+++CqdCGnqakkdCah RCRtCCk+rgf C+thvkstW+paakrrerq              +++ +kr+ +   +  s           s
  Lj1g3v2140900.1  78 GGGVNCQDCGNQAKKDCAHLRCRTCCKTRGFPCQTHVKSTWIPAAKRRERQLLRGGE--------DNNVPKRHSS---NPPS-----------S 149
                      5789*********************************************97655543........2222333322...1222...........2 PP

           DUF702  97 kkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                      ++ le+ ++P+ev+s+avfrcvrvs+v+ +ee +aYqt v+igGhvfkGiLydqG+e+
  Lj1g3v2140900.1 150 TTGLEAGQFPTEVNSTAVFRCVRVSGVECAEERCAYQTCVNIGGHVFKGILYDQGPES 207
                      23467789************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051422.7E-5180206IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016239.8E-2682124IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016242.9E-24157205IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MAGLFSLGPQ NKLEVEKEES SVLWFRNEEI YNNNNKGFEI WPPQQNLLNY NNEEITSLCE  60
AASRRRFGMM MSRRGGGGGG VNCQDCGNQA KKDCAHLRCR TCCKTRGFPC QTHVKSTWIP  120
AAKRRERQLL RGGEDNNVPK RHSSNPPSST TGLEAGQFPT EVNSTAVFRC VRVSGVECAE  180
ERCAYQTCVN IGGHVFKGIL YDQGPESSYT TSTVVGEGSS AGGGGAKQLG FVTATNTATT  240
SGNPYFDPSL YPAPLNAFMA GTHFFPPSRS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0061100.0AP006110.1 Lotus japonicus genomic DNA, chromosome 1, clone: LjT39G11, TM0195b, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007136048.11e-100hypothetical protein PHAVU_009G0137001g, partial
SwissprotQ9LQZ58e-70SRS5_ARATH; Protein SHI RELATED SEQUENCE 5
TrEMBLV7AQV41e-100V7AQV4_PHAVU; Uncharacterized protein (Fragment)
STRINGGLYMA04G03000.14e-97(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF88234125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.11e-62Lateral root primordium (LRP) protein-related